PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016491352.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB_related
Protein Properties Length: 726aa    MW: 80746.1 Da    PI: 4.4823
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016491352.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding409e-13574615346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rW+++E el+++av+q+G++  ++I + ++ gRt+ q+k+++ k
   XP_016491352.1 574 RWSKQETELFYEAVQQFGTD-LSLIQQLFP-GRTRRQLKLKYKK 615
                      9*******************.*********.***********87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF159631.0E-28565649No hitNo description
PROSITE profilePS5129311.203570618IPR017884SANT domain
SMARTSM007173.1E-10571619IPR001005SANT/Myb domain
SuperFamilySSF466898.97E-11573622IPR009057Homeodomain-like
CDDcd001672.62E-8574615No hitNo description
Gene3DG3DSA:1.10.10.606.4E-8574615IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 726 aa     Download sequence    Send to blast
MDLLDDILAD GASKTVKAGG KFQPKAKPRP VKKGPAVASS TVSLTSKPTG DTVATDSFEA  60
LKKDGKNSQN YYEQSSVLAE PSLEHPLAAE TLCPSVGSYL DTSTVVPDNS EDSKTCLEKS  120
EGEYADIYIG LDSFDDLLPT SSAIENSSPA TDPSAVHVDG AEKGQDQLSI PVSSVDDSAP  180
STSNLQPDEV AGCQDPLTCQ GSVVPVSGSC QMEMDSYPSL EADILGVTTT SGQSTRRFQP  240
KSKLQVYRER YDTSIPDSDA VESVSCQPNS HSVHSEMDFV DRGKEHGFPA DDVLDFSARG  300
FDNNIITEST HEFPVHEEYV IEASHSDVRI PAELHESTSQ MPEEPVHQRP KTKKQKLPAS  360
DLSAITEENG AGRSLRSRRK SVNANRLVDE SEVVADDGEY VPEQPNDSVT NGNNEDLLVE  420
NESQGKKVQK KSKRTVAEDG KQVRKSKKTT EASDQAANKK PKKFSHSTRQ KRRQVNKALL  480
EAPEYEIDYQ KVPIKDLIIL GEHRERLAKK DAAASQIPTT DQSTGASVSN YNEDETYPSD  540
DGAEDNDHQI GSRAQDSSAY FNYQTYMDKT PSTRWSKQET ELFYEAVQQF GTDLSLIQQL  600
FPGRTRRQLK LKYKKEERQH PFRLHDALTN RSKDHSHFER VIERLKQIEA EELQKADKDE  660
SIDLTGEQEV EEGTQEINEE EANSENVEKK EVEAVEQQDV PEMESPIEDY DSEDDSWRWS  720
QYKSEV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU0488873e-94GU048887.1 Capsicum annuum clone BAC CaCM511O09_Contig, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016491350.10.0PREDICTED: uncharacterized protein LOC107811026 isoform X2
RefseqXP_016491352.10.0PREDICTED: transcription factor TFIIIB component B''-like isoform X4
RefseqXP_016491353.10.0PREDICTED: transcription factor TFIIIB component B''-like isoform X4
RefseqXP_016491354.10.0PREDICTED: transcription factor TFIIIB component B''-like isoform X4
TrEMBLM1BI380.0M1BI38_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000457280.0(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39160.13e-50MYB_related family protein